2. Neurological Disease

Neurological Disease

Neurological Disease

Related Products

PDF 88.0 MB

A range of neurological disorders, including epilepsy and dystonia, may involve dysfunctional intracortical inhibition, and may respond to treatments that modify it. Parkinson’s is a neurodegenerative disease characterized by increased activity of GABA in basal ganglia and the loss of dopamine in nigrostriatum, associated with rigidity, resting tremor, gait with accelerating steps, and fixed inexpressive face. Neurological deficits, along with neuromuscular involvement, are characteristic of mitochondrial disease, and these symptoms can have a dramatic impact on patient quality of life. Neurological features may be manifold, ranging from neural deafness, ataxia, peripheral neuropathy, migraine, seizures, stroke‐like episodes and dementia and depend on the part of the nervous system affected.

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-B1213S
    Trimipramine-d3 maleate 1185245-93-5
    Trimipramine-d3 (maleate) is the deuterium labeled Trimipramine maleate. Trimipramine maleate is a 5-HT receptor antagonist, with pKis of 6.39, 8.10, 4.66 for 5-HT1C, 5-HT2 and 5-HT1A, respectively[1][2].
    Trimipramine-d3 maleate
  • HY-N10356
    4,27-Dimethyl withaferin A 1777780-95-6
    4,27-Dimethyl withaferin A is a synthetic analog of withanolide natural products. 4,27-Dimethyl withaferin A has the potential for the research of neurodegenerative diseases (extracted from patent WO2015077780A1).
    4,27-Dimethyl withaferin A
  • HY-P3431A
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
  • HY-B0031S2
    Quetiapine-d8 fumarate 1185247-12-4
    Quetiapine-d8 (fumarate) is the deuterium labeled Quetiapine. Quetiapine is a 5-HT receptors agonist with a pEC50 of 4.77 for human 5-HT1A receptor. Quetiapine is a dopamine receptor antagonist with a pIC50 of 6.33 for human D2 receptor. Quetiapine has moderate to high affinity for the human D2, HT1A, 5-HT2A, 5-HT2C receptor with pKis of 7.25, 5.74, 7.54, 5.55. Antidepressant and anxiolytic effects[1][2].
    Quetiapine-d8 fumarate
  • HY-B0196AS
    Venlafaxine-d10 hydrochloride 1216539-56-8
    Venlafaxine-d10 (hydrochloride) is the deuterium labeled Venlafaxine hydrochloride. Venlafaxine (Wy 45030) hydrochloride is an orally active, potent serotonin (5-HT)/norepinephrine (NE) reuptake dual inhibitor. Venlafaxine is an antidepressant[1][2].
    Venlafaxine-d10 hydrochloride
  • HY-B0262S1
    Methocarbamol-d3 1346600-86-9 98.15%
    Methocarbamol-d3 is the deuterium labeled Methocarbamol. Methocarbamol is an orally active central muscle relaxant and blocks muscular Nav1.4 channel. Methocarbamol reversibly affects voltage dependence of inactivation of Nav1.4 channel. Methocarbamol has the potential for muscle spasms and pain syndromes research[1][2][3].
    Methocarbamol-d3
  • HY-10847
    SB-277011 215803-78-4
    SB-277011 is a potent and delective dopamine D3 receptor antagonist (pKi values are 8.0, 6.0, 5.0 and <5.2 for D3, D2, 5-HT1D and 5-HT1B respectively); brain penetrant.
    SB-277011
  • HY-A0040
    Talipexole 101626-70-4
    Talipexole (B-HT920) is a dopamine agonist that has been proposed as an antiparkinsonian agent.
    Talipexole
  • HY-N0788
    Indaconitine 4491-19-4 ≥99.0%
    Indaconitine is a natural product.
    Indaconitine
  • HY-P0186
    Endomorphin 2 141801-26-5
    Endomorphin 2, a high affinity, highly selective agonist of the μ-opioid receptor, displays reasonable affinities for kappa3 binding sites, with Ki value between 20 and 30 nM.
    Endomorphin 2
  • HY-P0236
    Neurokinin A(4-10) 97559-35-8
    Neurokinin A (4-10) is a tachykinin NK2 receptor agonist.
    Neurokinin A(4-10)
  • HY-P0249
    Phe-Met-Arg-Phe, amide 64190-70-1
    Phe-Met-Arg-Phe, amide dose dependently (ED50=23 nM) activates a K+ current in the peptidergic caudodorsal neurons.
    Phe-Met-Arg-Phe, amide
  • HY-P0250
    Kassinin 63968-82-1
    Kassinin is a peptide derived from the Kassina frog. It belongs to tachykinin family of neuropeptides. It is secreted as a defense response, and is involved in neuropeptide signalling.
    Kassinin
  • HY-P0255
    Physalaemin 2507-24-6
    Physalaemin, a non-mammalian tachykinin, binds selectively to neurokinin-1 (NK1) receptor with high affinity.
    Physalaemin
  • HY-P0268
    Myomodulin 110570-93-9
    Myomodulin is a neuropeptide present in molluscs, insects, and gastropods.
    Myomodulin
  • HY-19845A
    Ordopidine hydrochloride 871351-61-0
    Ordopidine hydrochloride is a modulator of dopamine receptor extracted from patent WO/2005/121087A1, compound example 2; exhibits an ED50 of 68 μmol/kg on increase of DOPAC in the rat striatum.
    Ordopidine hydrochloride
  • HY-U00204
    Nisobamate 25269-04-9
    Nisobamate (W1015) is a tranquilizer.
    Nisobamate
  • HY-U00207
    MEN11467 214487-46-4
    MEN11467 is a selective and orally- effective peptidomimetic tachykinin NK1 receptor antagonist.
    MEN11467
  • HY-U00240
    SA72 934809-60-6
    SA72 is a highly selective fatty acid amide hydrolase (FAAH) inhibitor.
    SA72
  • HY-U00241
    Carburazepam 59009-93-7
    Carburazepam is a agent which derives from benzodiazepine. Benzodiazepines (BZD, BZs) are a class of psychoactive agents whose core chemical structure is the fusion of a benzene ring and a diazepine ring.
    Carburazepam
Cat. No. Product Name / Synonyms Application Reactivity